PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_12730V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 848aa    MW: 95268.7 Da    PI: 6.6825
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_12730V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-15373419148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT eEd  l+++vk++G  +W++Ia+++  gR +kqc++rw+++l
  Pp3c17_12730V3.2.p 373 KGLWTIEEDRHLIELVKRYGQQRWTLIANYLS-GRIGKQCRERWHNHL 419
                         678*****************************.*************97 PP

2Myb_DNA-binding445.1e-14427467345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          W+ eE+e lv +++ lG++ W+ Ia+ ++ gRt++ +k++w+
  Pp3c17_12730V3.2.p 427 GWSSEEEEYLVFVHNTLGNR-WADIAKLIP-GRTENAIKNHWN 467
                         6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.013368423IPR017930Myb domain
SuperFamilySSF466898.24E-29370466IPR009057Homeodomain-like
SMARTSM007176.3E-14372421IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-25374426IPR009057Homeodomain-like
CDDcd001671.24E-12376419No hitNo description
PfamPF139218.6E-17376434No hitNo description
SMARTSM007172.2E-12424472IPR001005SANT/Myb domain
PROSITE profilePS5129417.005424474IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-19427473IPR009057Homeodomain-like
CDDcd001673.89E-9428467No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 848 aa     Download sequence    Send to blast
MERPDFRGPM ETKIPETVDG ETRMFIKHPD VVLTTLGNSS RPIGSCVLDQ VLDSPINFLG  60
SSLQHQILGS LRLNGVLSSS CPTSATFNFK QSSRSITGKF VTSEQEYLLQ QQGSSIGSCR  120
AQLSAAESNS VAVDNTNKAA RQDERWIGDR LLDTETFKNE LEFEQQKAKR AHLLDRQWES  180
EPHSVSTSRV WSSKRPKPSQ QQHELRSVPC PPVPRSKTTI GLYHEGPVVG HVAEYIDFEE  240
LDLQQLKDVN VTEKFQGYFC SNENPHKIVA GGGSISDRRQ KLGNTRCDDF PEKVHETVVS  300
IDQSEESLPS GSGNGLGESC HDVGGTAECN YLILPGTEPD EVFQSDPHDI DFSSKSFMNS  360
SSQRGPHRQN TIKGLWTIEE DRHLIELVKR YGQQRWTLIA NYLSGRIGKQ CRERWHNHLR  420
PDIKKEGWSS EEEEYLVFVH NTLGNRWADI AKLIPGRTEN AIKNHWNATM RRKDLRRKHR  480
RPVGGSKCGP VEPVSRCTIL RDYQQKVVAQ AKRKGNTHET TSPSNPDHFE LDQHKRLSKN  540
TCPYNTQIAG NSDTNWNTEK SEYQRLVQIK EMRSEERKQL SYTICRGGEE GDPDFSNAPQ  600
GSVVLQHGRS GSVFNQDWRN CGQYENNGMY STPPLWIPSF RGTEKSEGDS YISGGRWHVP  660
RDDVTWSQMA ADNSDAGLNQ RKIDHHTVHC LSHCNPLQQR SSESHTRFDT QGSQLENEVL  720
HSKIRGIKNV SVTLDPTSGV QMAPPAQSDC EYTDSSSPNL NMAHLTLPLN SLQNYFGDSR  780
NILTEVEPHQ LDHGVCCLPC QTLGIADLRT NLGYLSQEHW RPAAVEGRNS GNLPAAGEID  840
FIEIIAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-433704734107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S313_81V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.14e-44myb domain protein 119